0.9

Adjusted Signal

0.9

Raw Pattern Score

100%

Time Factor

2026-11-01

Last Push

5.2K

Stars

Java

Language

1.0M

Lines of Code

8.5K

Files

491

Pattern Hits

2026-10-31

Scan Date

0.00

HC Hit Rate

Risk Review · Payload v1

Use each vector to guide manual verification of the underlying findings.

Payload schema: 1.0.0 · Engine: 2.0.0 · Scoring: heuristic-density-v1 · Scan date: 2026-10-31.

Cognitive Ownership Risk 3.9/100 · LOW

Can maintainers explain intent, assumptions, and trade-offs? 457 finding(s).

Hallucinated Dependency & Supply Chain Risk 0.6/100 · LOW

Are imports declared and package/API names verified? 20 finding(s).

Agent Over-Engineering Ratio 0.7/100 · LOW

Are wrappers, guards, and repeated structures necessary? 136 finding(s).

PR Review Velocity Impact 5.7/100 · LOW

Which changes need focused human review? 491 finding(s).

What These Metrics Mean

Adjusted Signal: Legacy pattern score normalized per 1,000 scanned lines and multiplied by the repository-level time factor. It is not an estimate of AI authorship.
Raw Pattern Score: Sum of severity- and context-weighted pattern findings before applying the time factor.
Time Factor: A coarse multiplier based on repository last-push metadata. It does not identify when individual code was written.
Pattern Hits: Count of configured pattern findings. Review each location and surrounding code before acting.
HC Hit Rate: High- and critical-severity findings per scanned file. Severity is a configured detector weight, not proof of a vulnerability or authorship.
Lines / Files: Scan coverage denominators used by the legacy normalized score.

Pattern-Signal History

This chart tracks the legacy adjusted pattern score across scan runs. Changes can reflect source changes, scan coverage, or detector/scoring versions; they do not measure AI adoption or prove that a team refactored code. Compare runs only when their scoring versions are compatible. The dashed line tracks the raw pattern-hit count.

Severity Breakdown

Groups findings by configured severity weight. Severity is not a confidence estimate, security rating, or proof that a package is missing. Verify imports against the project's manifests and inspect each finding in its local design context.

CRITICAL 10HIGH 12MEDIUM 276LOW 193

Directory Score Breakdown

This horizontal bar chart shows where configured pattern scores accumulate across directories. Treat the bars as locations to inspect, not as evidence of authorship or code quality. Use the file-level findings to decide whether a directory needs a focused ownership, dependency, complexity, or review check.

Pattern Findings

The scanner identified 491 distinct pattern matches across 15 syntactic categories. Each entry below represents a discrete location in the source code where the engine recorded a detector match to inspect in context. Expand any category row to inspect the individual file paths, line numbers, code snippets, and the lexical context (CODE, COMMENT, or STRING) in which each match was detected.

Reading the findings table: The Severity column indicates the configured finding weight (CRITICAL / HIGH / MEDIUM / LOW). The Context column identifies whether the match occurred inside executable code, an inline comment, or a string literal — legacy comment-context matches receive a ×1.5 score weight. The ⚡ bolt icon marks clustered matches: three or more patterns within a 10-line window, each receiving an additional ×1.5 density multiplier under the legacy scoring model.

AI Slop Vocabulary143 hits · 305 pts

Severity	File	Line	Snippet	Context
MEDIUM	…371_journal.pone.0307795.training.segmentation.tei.xml	162	<body>#2181018) was diluted 1:400 in Co-detection Antibody Diluent and applied to the samples <lb/>overnight in a humid	CODE
MEDIUM	…tei/10.7554_elife.104068.training.segmentation.tei.xml	206	<front>Taylor W. Webb <lb/>Department of Psychology, University of California, Los Angeles <lb/>For correspondence: t	CODE
MEDIUM	…/10.5194_bg-21-4533-2024.training.segmentation.tei.xml	230	<listBibl>resolution based on satellite information for use in land surface, <lb/>meteorological and climate models, Ge	CODE
MEDIUM	…tion/corpus/tei/009027v1.training.segmentation.tei.xml	33	<body>Figure 4 -Disruption of Ten-a expression in mid-pupa affect behavioral variance. a. Time-courses of sliding win	CODE
MEDIUM	…40_mpaed_58_2024.07.01.x.training.segmentation.tei.xml	50	<front>Barth, René. 2024. «Stealth Gamification in der selbstgesteuerten non-formalen Erwachsenenbildung. Argumente	CODE
MEDIUM	…tion/corpus/tei/E14-1075.training.segmentation.tei.xml	61	G i #words PROB LLR MRW REGBASIC REGSUM <lb/> G 1 <lb/> 80 <lb/>43.6 <lb/>37.9 <lb/>38.9 <lb/>39.9 <lb/>45.7 <lb/>	CODE
MEDIUM	…s/tei/10.1039_d4ma00118d.training.segmentation.tei.xml	92	<body>SA and methanesulfonic acid (CH 3 SO 3 OH, MSA) are signi-<lb/>cant products of Earth's sulfur cycle with	CODE
MEDIUM	…s/tei/10.1039_d4ma00118d.training.segmentation.tei.xml	200	<listBibl>A. Laaksonen, K. Lehtipalo, M. Leiminger, J. Leppä, <lb/>V. Loukonen, V. Makhmutov, S. Mathot, M. J. McGrat	CODE
MEDIUM	…on/corpus/tei/PMC3858645.training.segmentation.tei.xml	85	<listBibl>Péruch, P., Borel, L., Magnan, J., and Lacour, M. (2005). Direction and distance <lb/>deficits in path inte	CODE
MEDIUM	…016_j.biopha.2024.117014.training.segmentation.tei.xml	7	<front>Heliyon 10 (2024) e27580 <lb/>Available online 4 March 2024 <lb/>2405-8440/© 2024 The Authors. <lb/>Published	CODE
MEDIUM	…rpus/tei/10.1145_3632925.training.segmentation.tei.xml	131	<body>M : W( , 1) is co-before T2's W ( , 1). This execution is dropped because co contradicts thread-order	CODE
MEDIUM	…10.1088_1748-9326_ab751c.training.segmentation.tei.xml	21	<body>instruments. This paper is structured as follows: <lb/>section 2 includes a brief description of the model <lb/	CODE
MEDIUM	…Computational_Efficiency.training.segmentation.tei.xml	162	<listBibl>[63] Y. Wang, R. Huang, S. Song, Z. Huang, and G. Huang, ''Not all <lb/>images are worth 16×16 wo	CODE
MEDIUM	…y_composing_monad_936160.training.segmentation.tei.xml	9	<body>1 Introduction <lb/>I really liked Phil Wadler's work on monads 15, 16]. <lb/>But I was not entirely satis	CODE
MEDIUM⚡	…tion/corpus/tei/133108v1.training.segmentation.tei.xml	45	<listBibl>References and Notes <lb/>1 Khatri, P., Sirota, M. & Butte, A. J. <lb/>Ten years of pathway analysis: c	CODE
MEDIUM⚡	…tion/corpus/tei/133108v1.training.segmentation.tei.xml	45	<listBibl>References and Notes <lb/>1 Khatri, P., Sirota, M. & Butte, A. J. <lb/>Ten years of pathway analysis: c	CODE
MEDIUM⚡	…tion/corpus/tei/133108v1.training.segmentation.tei.xml	45	<listBibl>References and Notes <lb/>1 Khatri, P., Sirota, M. & Butte, A. J. <lb/>Ten years of pathway analysis: c	CODE
MEDIUM	…tion/corpus/tei/010637v1.training.segmentation.tei.xml	125	<listBibl>REFERENCES <lb/>Altshuler, D., V. J. Pollara, C. R. Cowles, W. J. Van Etten, J. Baldwin et al., 2000 An SNP	CODE
MEDIUM	…tion/corpus/tei/416743v1.training.segmentation.tei.xml	37	<body>A <lb/>B <lb/>C <lb/>D <lb/>Fig. 4. The Transite website analysis submission forms for TSMA and SPMA make the T	CODE
MEDIUM	….1186_s41043-024-00529-z.training.segmentation.tei.xml	163	<listBibl>REFERENCES <lb/>1. Jemec GBE. Hidradenitis suppurativa. N Engl J <lb/>Med. 2012;366(2):158-64. https:/	CODE
MEDIUM	…tei/journal.pwat.0000127.training.segmentation.tei.xml	19	<body>To date, most studies that have sought to quantify risk factors for interruptions in water ser-<lb/>vices have	CODE
MEDIUM	…/corpus/tei/ele0017-1464.training.segmentation.tei.xml	23	Literature search criteria <lb/> On May 10, 2012 (and again on August 5, 2013 to update our <lb/>dataset), we searche	CODE
MEDIUM	…tion/corpus/tei/025940v1.training.segmentation.tei.xml	11	estimate the probability of detecting a species from this group as 1-Poiss(0, *dt), i.e. 1 minus the <lb/>probability	CODE
MEDIUM	…371_journal.pone.0210122.training.segmentation.tei.xml	7	<front>RESEARCH ARTICLE <lb/>Mapping the global potential distributions of <lb/>two arboviral vectors Aedes aegypti a	CODE
MEDIUM	…10.5194_acp-24-7227-2024.training.segmentation.tei.xml	86	<body>Section 7 summarizes access to the data products. Section 8 <lb/>discusses potential future acquisitions a	CODE
MEDIUM	…10.5194_acp-24-7227-2024.training.segmentation.tei.xml	134	<body>products and quality in measurements collected by different <lb/>groups across the ABoVE domain and across	CODE
MEDIUM	…10.5194_acp-24-7227-2024.training.segmentation.tei.xml	174	<body>while AirMOSS P-band data may be accessed via the ORNL <lb/>DAAC, https://daac.ornl.gov/get_data/#projects	CODE
MEDIUM	…10.5194_acp-24-7227-2024.training.segmentation.tei.xml	174	<body>while AirMOSS P-band data may be accessed via the ORNL <lb/>DAAC, https://daac.ornl.gov/get_data/#projects	CODE
MEDIUM	…0.1016_j.cub.2019.01.077.training.segmentation.tei.xml	9	<front>Current Biology <lb/>Article <lb/>A Computational Model of Visual <lb/>Recognition Memory via Grid Cells <lb/>A	CODE
MEDIUM	…1016_j.atech.2024.100578.training.segmentation.tei.xml	25	<body>>20 mm) or pathological type (GISTs and leiomyomas) <lb/>were conducted to investigate the performance of th	CODE
MEDIUM	…s/tei/s41467-024-52091-1.training.segmentation.tei.xml	75	<listBibl>References <lb/>1. Kühlbrandt, W. The resolution revolution. Science 343, <lb/>1443-1444 (2014). <lb/>2. Ha	CODE
MEDIUM	…0.3389_fpls.2024.1450893.training.segmentation.tei.xml	56	<body>progression of symptoms related to AD, including cognition decline <lb/>(Justice, 2018; Lesuis et al., 2018).	CODE
MEDIUM	…0.3389_fpls.2024.1450893.training.segmentation.tei.xml	56	<body>progression of symptoms related to AD, including cognition decline <lb/>(Justice, 2018; Lesuis et al., 2018).	CODE
MEDIUM	…on/corpus/tei/PMC4491109.training.segmentation.tei.xml	101	<body>118.7, 119.6, 120.8, 123.1, 125.8, 131.6, 138.8 (-CF 3 , <lb/>6C aromatic ), 170.9 (-CO-); 19 F NMR (282 MHz, D	CODE
MEDIUM	….1186_s12889-024-20161-0.training.segmentation.tei.xml	62	<front>1 <lb/>Vol.:(0123456789) <lb/>Scientific Reports \| <lb/>(2024) 14:9127 <lb/>\| https://doi.org/10.1038/s41598-	CODE
MEDIUM	…ei/10.1515_ans-2023-0146.training.segmentation.tei.xml	69	<body>(1) T f = f on E and ‖T f ‖ L m, p (ℝ n ) ≤ C m,n, p ‖ f ‖ L m, p (E) for all f ∈ L m, p (E). <lb/>(2) Let	CODE
MEDIUM	…ei/10.1515_ans-2023-0146.training.segmentation.tei.xml	117	<body>Proof. Suppose that the shadows J, J satisfy J ∈ Gp(x * ) and J ∈ Gp(x * ) for two points x * , x * ∈ E +	CODE
MEDIUM	…rpus/tei/1111._sdarticle.training.segmentation.tei.xml	67	<body>Table 5 Test results for the example data set from Selvin [38] <lb/>Least-squares <lb/>Robust <lb/>Test <lb/>F/	CODE
MEDIUM	….5194_nhess-24-2689-2024.training.segmentation.tei.xml	50	<front>Atmos. Chem. Phys., 24, 1415-1427, 2024 <lb/>https://doi.org/10.5194/acp-24-1415-2024 <lb/>© Author(s) 2024. Thi	CODE
MEDIUM	…on/corpus/tei/PMC4990296.training.segmentation.tei.xml	69	<body>[9]. Importantly, urolithiasis is associated with a 30-50% risk of recurrence within seven years <lb/>of initia	CODE
MEDIUM	…0473_jisebi.10.1.139-151.training.segmentation.tei.xml	91	<listBibl>[2] Pan American Health Organization and World Health Organization, "5 Things to Know About Viral Hepa	CODE
MEDIUM	…/corpus/tei/2307.01952v1.training.segmentation.tei.xml	13	<body>Table 1: Comparison of SDXL and older Stable Diffusion models. <lb/>Model <lb/>SDXL <lb/>SD 1.4/1.5 <lb/>SD 2.0	CODE
MEDIUM	…0_1807-7692bar2024230129.training.segmentation.tei.xml	189	<listBibl>Perren, R., & Kozinets, R. (2018). Lateral exchange markets: How social <lb/>platforms operate in	CODE
MEDIUM	…ei/10.1515_med-2024-0960.training.segmentation.tei.xml	72	<front>Annika Meyer*, Johannes Ruthard and Thomas Streichert <lb/>Dear ChatGPT -can you teach me how to program	CODE
MEDIUM	…ei/10.1515_med-2024-0960.training.segmentation.tei.xml	110	<listBibl>5. Haymond S, Master S. Why clinical laboratorians should embrace the R <lb/>Programming Language -a c	CODE
MEDIUM	…1016_j.mcpro.2024.100860.training.segmentation.tei.xml	7	<front>Heliyon 10 (2024) e33389 <lb/>Available online 21 June 2024 <lb/>2405-8440/© 2024 The Authors. <lb/>Published	CODE
MEDIUM	…1016_j.mcpro.2024.100860.training.segmentation.tei.xml	29	<body>project, a PED is defined as a district that achieves net zero energy import and net zero carbon emissions annu	CODE
MEDIUM	…1016_j.mcpro.2024.100860.training.segmentation.tei.xml	29	<body>project, a PED is defined as a district that achieves net zero energy import and net zero carbon emissions annu	CODE
MEDIUM	…on/corpus/tei/sdata20191.training.segmentation.tei.xml	85	<listBibl>References <lb/>1. Mikhael, S., Hoogendoorn, C., Valdes-Hernandez, M. & Pernet, C. A critical analysis	CODE
MEDIUM	…0.1177_17588359241303302.training.segmentation.tei.xml	98	<front>https://doi.org/10.1177/17562848241256237 <lb/>https://doi.org/10.1177/17562848241256237 <lb/>Ther Adv Gastro	CODE
MEDIUM	…/tei/10.14814_phy2.16127.training.segmentation.tei.xml	206	<body>benefit, they adjusted their economic benchmarks <lb/>upwards and were consequently disappointed by the la	CODE
MEDIUM	…tion/corpus/tei/574962v1.training.segmentation.tei.xml	13	<body>deciphers Hi-C data into polymer dynamics simulations (Fig. 1a, https://github.com/ <lb/>soyashinkai/PHi-C). PH	CODE
MEDIUM	…371_journal.pone.0298111.training.segmentation.tei.xml	208	<listBibl>15. Liu X, Kou Y, Shockley J, Smith JS. How does supplier CSR performance help to expand exchange <lb/>rel	CODE
MEDIUM	…on/corpus/tei/PMC5472746.training.segmentation.tei.xml	9	<body>A <lb/>naplastic lymphoma kinase (ALK) is a member of the <lb/>insulin receptor family of receptor tyrosine kin	CODE
MEDIUM	…tion/corpus/tei/265553v1.training.segmentation.tei.xml	27	<body>Dialogue on Reverse Engineering and Assessment (DREAM) is a community-driven initiative <lb/>promoting open-dat	CODE
MEDIUM	…/10.5194_os-20-1441-2024.training.segmentation.tei.xml	478	<listBibl>Otosaka, I. N., Shepherd, A., Ivins, E. R., Schlegel, N.-J., Amory, <lb/>C., van den Broeke, M. R., Horwath,	CODE
MEDIUM	…371_journal.pone.0307795.training.segmentation.tei.xml	162	<body>#2181018) was diluted 1:400 in Co-detection Antibody Diluent and applied to the samples <lb/>overnight in a humid	CODE
MEDIUM	…entation/article/light/corpus/tei/detailed_analysis.py	168	# Generate comprehensive report	COMMENT
MEDIUM	…tei/10.7554_elife.104068.training.segmentation.tei.xml	206	<front>Taylor W. Webb <lb/>Department of Psychology, University of California, Los Angeles <lb/>For correspondence: t	CODE
MEDIUM	…/10.5194_bg-21-4533-2024.training.segmentation.tei.xml	230	<listBibl>resolution based on satellite information for use in land surface, <lb/>meteorological and climate models, Ge	CODE
83 more matches not shown…

Slop Phrases98 hits · 205 pts

Severity	File	Line	Snippet	Context
MEDIUM	…tei/10.7554_elife.104068.training.segmentation.tei.xml	38	<body>2.1.2 Arithmetic task <lb/>We tested two types of arithmetic operations, corresponding to the translation and s	CODE
MEDIUM	…s/tei/0951-7715_24_7_004.training.segmentation.tei.xml	76	which belongs to the class of su(1, 1) generalized Tavis–Cummings model discussed in<lb/> [10]. Applying the results	CODE
MEDIUM	…pus/tei/1046._p33-hearst.training.segmentation.tei.xml	137	<body>5.4 Smoothing the Plot <lb/>As mentioned above, the plot is smoothed to remove small dips, using average smooth	CODE
MEDIUM	…tion/corpus/tei/903906v1.training.segmentation.tei.xml	91	<body>high for CBS, correlating with the increased β-sheets in CBS (Fig. 6). How this increase of β-<lb/>sheets could	CODE
MEDIUM	…i/10.5194_ms-15-461-2024.training.segmentation.tei.xml	178	<body>fill methane emissions for short-and long-term temporal-<lb/>variability studies. Such an approach could be comp	CODE
MEDIUM	…on/corpus/tei/CN-23-8-07.training.segmentation.tei.xml	73	<body>Index <lb/>Name <lb/>Database <lb/>P-value <lb/>q-value <lb/>OR <lb/>12 <lb/>Alcoholic Intoxication, Chronic <l	CODE
MEDIUM	…on/corpus/tei/PMC4979692.training.segmentation.tei.xml	24	<body>Figure 3: SEM images (a) of the fabricated sensor, (b) and (c) of the free end of the FeCNT before and after ca	CODE
MEDIUM	…/tei/550._10.1.1.47.7508.training.segmentation.tei.xml	76	<body>On each iteration of the BBP algorithm, an input is selected from the pool of candidates and <lb/>added to the	CODE
MEDIUM	…/tei/492._10.1.1.62.4528.training.segmentation.tei.xml	25	<body>We remark that we need the sequence of plausibility mea-<lb/>sures ¨todealwithtuplesofdifferentarity. The analo	CODE
MEDIUM	…on/corpus/tei/270._45580.training.segmentation.tei.xml	51	<body>we extend both de nitions to the multi-document set-<lb/>ting. <lb/>Basic security. Basic security addresses a	CODE
MEDIUM	…on/corpus/tei/PMC1933159.training.segmentation.tei.xml	14	<body>program, (2) inteRNA, a program for predicting the joint <lb/>secondary structure of two interacting RNAs and <	CODE
MEDIUM	…tion/corpus/tei/029892v1.training.segmentation.tei.xml	49	<body>data from the only other annelid where wnt1 has been investigated does not support a <lb/>role in segmentation	CODE
MEDIUM	…371_journal.pone.0308803.training.segmentation.tei.xml	86	<body>Michigan State University. As discussed in our earlier paper [28] the camera was mounted at <lb/>the back of the	CODE
MEDIUM	…tion/corpus/tei/351494v1.training.segmentation.tei.xml	22	The initial conditions for a path sampling simulation con-<lb/>sist of a SampleSet with at least one Sample for any p	CODE
MEDIUM	…41598_2018_Article_37721.training.segmentation.tei.xml	19	<body>Results <lb/>GM6001 affects fertilisation. Putative metalloproteases belonging to the astacin superfamily were	CODE
MEDIUM	…10.1515_nanoph-2023-0655.training.segmentation.tei.xml	166	<body>entirely independent constructions, one would predict that children may show <lb/>differences in how accur	CODE
MEDIUM	…on/corpus/tei/PMC6779742.training.segmentation.tei.xml	37	<body>Increased myelination during neonatal development in the <lb/>frontal brain of both male and female BTBR mice <	CODE
MEDIUM	…371_journal.pcbi.1012669.training.segmentation.tei.xml	160	<body>Low income and its relationship with CVRs and CVEs parallels that of education and <lb/>occupation. Khaing et a	CODE
MEDIUM	…Faraday-discuss-post-ref.training.segmentation.tei.xml	37	<body>compounds on the basis of DFT calculations 37,39 , in particular using "Quantum Theory of Atoms in <lb/>Mo	CODE
MEDIUM	…Faraday-discuss-post-ref.training.segmentation.tei.xml	41	<body>-28/3 eǺ -5 at 105K and -19/-1 in average at 15K. Such a discrepancy between experiment and theory <lb/>has alr	CODE
MEDIUM	…i/1027._PhyRevD77-064013.training.segmentation.tei.xml	13	<body>A H =a 2 , where A H is the area of the boundary of the <lb/>region being traced over (the ''horizon&	CODE
MEDIUM	…corpus/tei/1751-0473-5-9.training.segmentation.tei.xml	37	<body>layers as opposed to document validation only for the <lb/>Picasso platform [16]. This is a commercial tool tha	CODE
MEDIUM	…-analysis-resilience-ist.training.segmentation.tei.xml	47	# <lb/> ex-<lb/>ecuted <lb/>try-catch <lb/># purely <lb/>resilient <lb/>try-catch <lb/># source-<lb/>independent <lb	COMMENT
MEDIUM	…-analysis-resilience-ist.training.segmentation.tei.xml	57	This shows that our contracts are not purely theoretical: <lb/>they reflect properties of error-handling code that ca	CODE
MEDIUM	…/tei/10.5812_ijem-154255.training.segmentation.tei.xml	23	<body>randomization. In case of serious adverse events that <lb/>could potentially harm the participants, the patient	CODE
MEDIUM	…n/corpus/tei/qss_a_00170.training.segmentation.tei.xml	37	<body>21. Number of common keywords between the body of the cited and citing paper extracted <lb/>by YAKE (F21): We c	CODE
MEDIUM	…on/corpus/tei/1612_05721.training.segmentation.tei.xml	29	<body>TABLE I: Observed η ′ signal yields (N η ′ ) and detection efficiencies (ǫ) for inclusive η ′ → γγπ 0 , η ′ → γ	CODE
MEDIUM	…tei/10.7554_elife.104068.training.segmentation.tei.xml	38	<body>2.1.2 Arithmetic task <lb/>We tested two types of arithmetic operations, corresponding to the translation and s	CODE
MEDIUM	…s/tei/0951-7715_24_7_004.training.segmentation.tei.xml	76	which belongs to the class of su(1, 1) generalized Tavis–Cummings model discussed in<lb/> [10]. Applying the results	CODE
MEDIUM	…pus/tei/1046._p33-hearst.training.segmentation.tei.xml	137	<body>5.4 Smoothing the Plot <lb/>As mentioned above, the plot is smoothed to remove small dips, using average smooth	CODE
MEDIUM	…ight/corpus/tei/903906v1.training.segmentation.tei.xml	91	<body>high for CBS, correlating with the increased β-sheets in CBS (Fig. 6). How this increase of β-<lb/>sheets could	CODE
MEDIUM	…i/10.5194_ms-15-461-2024.training.segmentation.tei.xml	178	<body>fill methane emissions for short-and long-term temporal-<lb/>variability studies. Such an approach could be comp	CODE
MEDIUM	…ht/corpus/tei/CN-23-8-07.training.segmentation.tei.xml	73	<body>Index <lb/>Name <lb/>Database <lb/>P-value <lb/>q-value <lb/>OR <lb/>12 <lb/>Alcoholic Intoxication, Chronic <l	CODE
MEDIUM	…ht/corpus/tei/PMC4979692.training.segmentation.tei.xml	24	<body>Figure 3: SEM images (a) of the fabricated sensor, (b) and (c) of the free end of the FeCNT before and after ca	CODE
MEDIUM	…/tei/550._10.1.1.47.7508.training.segmentation.tei.xml	76	<body>On each iteration of the BBP algorithm, an input is selected from the pool of candidates and <lb/>added to the	CODE
MEDIUM	…/tei/492._10.1.1.62.4528.training.segmentation.tei.xml	25	<body>We remark that we need the sequence of plausibility mea-<lb/>sures ¨todealwithtuplesofdifferentarity. The analo	CODE
MEDIUM	…ht/corpus/tei/270._45580.training.segmentation.tei.xml	51	<body>we extend both de nitions to the multi-document set-<lb/>ting. <lb/>Basic security. Basic security addresses a	CODE
MEDIUM	…ht/corpus/tei/PMC1933159.training.segmentation.tei.xml	14	<body>program, (2) inteRNA, a program for predicting the joint <lb/>secondary structure of two interacting RNAs and <	CODE
MEDIUM	…ight/corpus/tei/029892v1.training.segmentation.tei.xml	49	<body>data from the only other annelid where wnt1 has been investigated does not support a <lb/>role in segmentation	CODE
MEDIUM	…371_journal.pone.0308803.training.segmentation.tei.xml	86	<body>Michigan State University. As discussed in our earlier paper [28] the camera was mounted at <lb/>the back of the	CODE
MEDIUM	…ight/corpus/tei/351494v1.training.segmentation.tei.xml	22	The initial conditions for a path sampling simulation con-<lb/>sist of a SampleSet with at least one Sample for any p	CODE
MEDIUM	…41598_2018_Article_37721.training.segmentation.tei.xml	19	<body>Results <lb/>GM6001 affects fertilisation. Putative metalloproteases belonging to the astacin superfamily were	CODE
MEDIUM	…10.1515_nanoph-2023-0655.training.segmentation.tei.xml	166	<body>entirely independent constructions, one would predict that children may show <lb/>differences in how accur	CODE
MEDIUM	…ht/corpus/tei/PMC6779742.training.segmentation.tei.xml	37	<body>Increased myelination during neonatal development in the <lb/>frontal brain of both male and female BTBR mice <	CODE
MEDIUM	…371_journal.pcbi.1012669.training.segmentation.tei.xml	160	<body>Low income and its relationship with CVRs and CVEs parallels that of education and <lb/>occupation. Khaing et a	CODE
MEDIUM	…Faraday-discuss-post-ref.training.segmentation.tei.xml	37	<body>compounds on the basis of DFT calculations 37,39 , in particular using "Quantum Theory of Atoms in <lb/>Mo	CODE
MEDIUM	…Faraday-discuss-post-ref.training.segmentation.tei.xml	41	<body>-28/3 eǺ -5 at 105K and -19/-1 in average at 15K. Such a discrepancy between experiment and theory <lb/>has alr	CODE
MEDIUM	…i/1027._PhyRevD77-064013.training.segmentation.tei.xml	13	<body>A H =a 2 , where A H is the area of the boundary of the <lb/>region being traced over (the ''horizon&	CODE
MEDIUM	…corpus/tei/1751-0473-5-9.training.segmentation.tei.xml	37	<body>layers as opposed to document validation only for the <lb/>Picasso platform [16]. This is a commercial tool tha	CODE
MEDIUM	…-analysis-resilience-ist.training.segmentation.tei.xml	47	# <lb/> ex-<lb/>ecuted <lb/>try-catch <lb/># purely <lb/>resilient <lb/>try-catch <lb/># source-<lb/>independent <lb	COMMENT
MEDIUM	…-analysis-resilience-ist.training.segmentation.tei.xml	57	This shows that our contracts are not purely theoretical: <lb/>they reflect properties of error-handling code that ca	CODE
MEDIUM	…/tei/10.5812_ijem-154255.training.segmentation.tei.xml	23	<body>randomization. In case of serious adverse events that <lb/>could potentially harm the participants, the patient	CODE
MEDIUM	…t/corpus/tei/qss_a_00170.training.segmentation.tei.xml	37	<body>21. Number of common keywords between the body of the cited and citing paper extracted <lb/>by YAKE (F21): We c	CODE
MEDIUM	…ht/corpus/tei/1612_05721.training.segmentation.tei.xml	29	<body>TABLE I: Observed η ′ signal yields (N η ′ ) and detection efficiencies (ǫ) for inclusive η ′ → γγπ 0 , η ′ → γ	CODE
MEDIUM	…rces/dataset/patent/citation/corpus/WO2004003140A2.xml	62	One of ordinary skill in the art will appreciate that some ambiguity is introduced in determining a degenerate codon, re	CODE
MEDIUM	…rces/dataset/patent/citation/corpus/WO2004003140A2.xml	73	The present invention provides an isolated an isolated multimeric cytokine receptor comprising a polypeptide having at l	CODE
MEDIUM	…rces/dataset/patent/citation/corpus/WO2004003140A2.xml	78	1) Antagonize or block signaling via a zcytorl7 multimeric cytokine </p> <p> receptor in the treatment of acute inflamma	CODE
MEDIUM	…sources/dataset/patent/citation/corpus/WO0100832A1.xml	202	and/or reducing agent; (c) purifying the Apo-2L by chromatography using, sequentially, a cationic exchanger, a hydroxya	CODE
MEDIUM	…s/dataset/patent/citation/corpus/US-20030001941-A1.xml	1	<?xml version="1.0" encoding="UTF-8"?><patent-document country="US" doc-number="20030001941" kind="A1" ucid="US-20030001	CODE
MEDIUM	…ources/dataset/patent/citation/corpus/WO03087836A1.xml	13	In one embodiment of the invention, nucleated cells are transfected with a nucleotide sequence encoding a protein compri	CODE
38 more matches not shown…

Hyper-Verbose Identifiers122 hits · 122 pts

Severity	File	Line	Snippet	Context
LOW	…mentation/pragmatic_segmenter/abbreviation_replacer.rb	31	def search_for_abbreviations_in_string(txt)	CODE
LOW	…mentation/pragmatic_segmenter/abbreviation_replacer.rb	65	def replace_abbreviation_as_sentence_boundary(txt)	CODE
LOW	…mentation/pragmatic_segmenter/abbreviation_replacer.rb	90	def replace_multi_period_abbreviations(txt)	CODE
LOW	…mentation/pragmatic_segmenter/abbreviation_replacer.rb	117	def replace_possessive_abbreviations(txt)	CODE
LOW	…egmentation/pragmatic_segmenter/between_punctuation.rb	45	def sub_punctuation_between_quotes_and_parens(txt)	CODE
LOW⚡	…egmentation/pragmatic_segmenter/between_punctuation.rb	56	def sub_punctuation_between_parens(txt)	CODE
LOW⚡	…egmentation/pragmatic_segmenter/between_punctuation.rb	63	def sub_punctuation_between_square_brackets(txt)	CODE
LOW⚡	…egmentation/pragmatic_segmenter/between_punctuation.rb	70	def sub_punctuation_between_single_quotes(txt)	CODE
LOW⚡	…egmentation/pragmatic_segmenter/between_punctuation.rb	80	def sub_punctuation_between_single_quote_slanted(txt)	CODE
LOW⚡	…egmentation/pragmatic_segmenter/between_punctuation.rb	87	def sub_punctuation_between_double_quotes(txt)	CODE
LOW⚡	…egmentation/pragmatic_segmenter/between_punctuation.rb	98	def sub_punctuation_between_quotes_arrow(txt)	CODE
LOW⚡	…egmentation/pragmatic_segmenter/between_punctuation.rb	105	def sub_punctuation_between_em_dashes(txt)	CODE
LOW⚡	…egmentation/pragmatic_segmenter/between_punctuation.rb	112	def sub_punctuation_between_quotes_slanted(txt)	CODE
LOW	…e/sentence-segmentation/pragmatic_segmenter/cleaner.rb	71	def search_for_connected_sentences(word, txt, regex, rule)	CODE
LOW	…sentence-segmentation/pragmatic_segmenter/processor.rb	61	def check_for_parens_between_quotes(txt)	CODE
LOW	…sentence-segmentation/pragmatic_segmenter/processor.rb	133	def sentence_boundary_punctuation(txt)	CODE
LOW⚡	…home/sentence-segmentation/pragmatic_segmenter/list.rb	123	def substitute_found_list_items(regex, a, strip, replacement)	CODE
LOW⚡	…home/sentence-segmentation/pragmatic_segmenter/list.rb	133	def add_line_breaks_for_alphabetical_list_with_periods(roman_numeral: false)	CODE
LOW⚡	…home/sentence-segmentation/pragmatic_segmenter/list.rb	137	def add_line_breaks_for_alphabetical_list_with_parens(roman_numeral: false)	CODE
LOW⚡	…home/sentence-segmentation/pragmatic_segmenter/list.rb	149	def replace_alphabet_list_parens(a)	CODE
LOW⚡	…home/sentence-segmentation/pragmatic_segmenter/list.rb	159	def replace_correct_alphabet_list(a, parens)	CODE
LOW⚡	…home/sentence-segmentation/pragmatic_segmenter/list.rb	167	def last_array_item_replacement(a, i, alphabet, list_array, parens)	CODE
LOW⚡	…-segmentation/pragmatic_segmenter/languages/chinese.rb	17	def sub_punctuation_between_quotes_and_parens(txt)	CODE
LOW⚡	…-segmentation/pragmatic_segmenter/languages/chinese.rb	23	def sub_punctuation_between_double_angled_quotation_marks(txt)	CODE
LOW⚡	…-segmentation/pragmatic_segmenter/languages/chinese.rb	30	def sub_punctuation_between_l_bracket(txt)	CODE
LOW	…e-segmentation/pragmatic_segmenter/languages/danish.rb	54	def replace_abbreviation_as_sentence_boundary(txt)	CODE
LOW⚡	…segmentation/pragmatic_segmenter/languages/japanese.rb	36	def sub_punctuation_between_quotes_and_parens(txt)	CODE
LOW⚡	…segmentation/pragmatic_segmenter/languages/japanese.rb	42	def sub_punctuation_between_quotes_ja(txt)	CODE
LOW⚡	…segmentation/pragmatic_segmenter/languages/japanese.rb	49	def sub_punctuation_between_parens_ja(txt)	CODE
LOW	…entation/article/light/corpus/tei/detailed_analysis.py	8	def extract_notes_with_context(file_path):	CODE
LOW	…s/web/resources/pdf.js/web/annotation_layer_builder.js	29	var AnnotationLayerBuilder = (function AnnotationLayerBuilderClosure() {	CODE
LOW	…s/web/resources/pdf.js/web/annotation_layer_builder.js	104	function DefaultAnnotationLayerFactory() {}	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	27	(function checkTypedArrayCompatibility() {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	108	(function checkObjectDefinePropertyCompatibility() {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	137	obj.__defineSetter__(name, function objectDefinePropertySetter(value) {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	138	this.__defineGetter__(name, function objectDefinePropertyGetter() {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	151	(function checkXMLHttpRequestResponseCompatibility() {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	158	value: function xmlHttpRequestOverrideMimeType(mimeType) {}	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	169	get: function xmlHttpRequestGetResponseType() {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	172	set: function xmlHttpRequestSetResponseType(value) {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	186	get: function xmlHttpRequestResponseGet() {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	198	get: function xmlHttpRequestResponseGet() {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	215	(function checkWindowBtoaCompatibility() {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	242	(function checkWindowAtobCompatibility() {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	276	(function checkFunctionPrototypeBindCompatibility() {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	283	var bound = function functionPrototypeBindBound() {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	397	(function checkConsoleCompatibility() {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	420	(function checkOnClickCompatibility() {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	491	(function checkSetPresenceInImageData() {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	540	(function checkRequestAnimationFrame() {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	541	function fakeRequestAnimationFrame(callback) {	CODE
LOW	…in/resources/web/resources/pdf.js/web/compatibility.js	560	(function checkCanvasSizeLimitation() {	CODE
LOW⚡	…/src/main/resources/web/resources/pdf.js/web/viewer.js	2224	presentationModeClick: function secondaryToolbarPresentationModeClick(evt) {	CODE
LOW⚡	…/src/main/resources/web/resources/pdf.js/web/viewer.js	2229	openFileClick: function secondaryToolbarOpenFileClick(evt) {	CODE
LOW⚡	…/src/main/resources/web/resources/pdf.js/web/viewer.js	2234	printClick: function secondaryToolbarPrintClick(evt) {	CODE
LOW⚡	…/src/main/resources/web/resources/pdf.js/web/viewer.js	2239	downloadClick: function secondaryToolbarDownloadClick(evt) {	CODE
LOW⚡	…/src/main/resources/web/resources/pdf.js/web/viewer.js	2244	viewBookmarkClick: function secondaryToolbarViewBookmarkClick(evt) {	CODE
LOW⚡	…/src/main/resources/web/resources/pdf.js/web/viewer.js	2248	firstPageClick: function secondaryToolbarFirstPageClick(evt) {	CODE
LOW⚡	…/src/main/resources/web/resources/pdf.js/web/viewer.js	2253	lastPageClick: function secondaryToolbarLastPageClick(evt) {	CODE
LOW⚡	…/src/main/resources/web/resources/pdf.js/web/viewer.js	2260	pageRotateCwClick: function secondaryToolbarPageRotateCwClick(evt) {	CODE
62 more matches not shown…

Hallucination Indicators10 hits · 110 pts

Severity	File	Line	Snippet	Context
CRITICAL	…e/src/main/java/org/grobid/core/document/Document.java	991	.add(org.apache.commons.lang3.tuple.Triple.of(oldFigure, f, figureLayoutTokens.getRight()));	CODE
CRITICAL	…e/src/main/java/org/grobid/core/document/Document.java	1436	return org.apache.commons.lang3.tuple.Pair.of(result, discardedPieces);	CODE
CRITICAL	…main/java/org/grobid/core/document/DocumentSource.java	341	Integer exitCode = org.grobid.core.process.ProcessPdfToXml.process(cmd);	CODE
CRITICAL	…n/java/org/grobid/core/utilities/GrobidProperties.java	491	\|\| grobidConfig.grobid.consolidation.crossref.mailto.trim().length() == 0)	CODE
CRITICAL	…n/java/org/grobid/core/utilities/GrobidProperties.java	517	\|\| grobidConfig.grobid.consolidation.crossref.token.trim().length() == 0)	CODE
CRITICAL	…main/java/org/grobid/core/utilities/TextUtilities.java	1632	return org.apache.commons.lang3.tuple.Pair.of(acronymPosition, basePosition);	CODE
CRITICAL	…va/org/grobid/core/utilities/counters/GrobidTimer.java	206	return org.grobid.core.utilities.Utilities.dateToString(new Date(pTime), MIN_SEC_MILI);	CODE
CRITICAL	…ore/src/main/java/org/grobid/core/data/BibDataSet.java	57	//sourceBib.add(org.grobid.core.utilities.TextUtilities.HTMLEncode(sentence));	COMMENT
CRITICAL	…ore/src/main/java/org/grobid/core/data/BibDataSet.java	62	//rawBib = org.grobid.core.utilities.TextUtilities.HTMLEncode(s);	COMMENT
CRITICAL	…rc/main/resources/web/resources/js/jquery-3.5.1.min.js	2	!function(e,t){"use strict";"object"==typeof module&&"object"==typeof module.exports?module.exports=e.document?t(e,!0):f	CODE

Synthetic Comment Markers12 hits · 60 pts

Severity	File	Line	Snippet	Context
HIGH	…1-4a2f-ace0-6113d752418a.training.segmentation.tei.xml	19	<body>Asian <lb/>Black <lb/>Hispanic <lb/>White <lb/>Ethnicity <lb/>Buddhist <lb/>Christian <lb/>Hindu <lb/>Jewish <l	CODE
HIGH	…1-4a2f-ace0-6113d752418a.training.segmentation.tei.xml	45	<body>laborer <lb/>cashier <lb/>monk <lb/>plumber <lb/>salesman <lb/>truck driver <lb/>software engineer <lb/>develop	CODE
HIGH	…1-4a2f-ace0-6113d752418a.training.segmentation.tei.xml	55	<body>scaling factor is γ(c) = G(c)E(c) <lb/>D(c) , where G(c), E(c) are the <lb/>gender-and ethnicity-shares of the	CODE
HIGH	…1-4a2f-ace0-6113d752418a.training.segmentation.tei.xml	79	<div type="annex">courier <lb/>barber <lb/>teller <lb/>contractor <lb/>magician <lb/>builder <lb/>printer <lb/>plumbe	CODE
HIGH	…ei/10.1515_med-2024-0960.training.segmentation.tei.xml	90	<body>In turn, inadequate proficiency in code reading and inter-<lb/>pretation present a security hazard [6], wi	CODE
HIGH	…ei/10.1515_cti-2024-0090.training.segmentation.tei.xml	97	<body>problems in the domain of work and cooperation. These <lb/>goals have obvious value, however we look to ex	CODE
HIGH	…1-4a2f-ace0-6113d752418a.training.segmentation.tei.xml	19	<body>Asian <lb/>Black <lb/>Hispanic <lb/>White <lb/>Ethnicity <lb/>Buddhist <lb/>Christian <lb/>Hindu <lb/>Jewish <l	CODE
HIGH	…1-4a2f-ace0-6113d752418a.training.segmentation.tei.xml	45	<body>laborer <lb/>cashier <lb/>monk <lb/>plumber <lb/>salesman <lb/>truck driver <lb/>software engineer <lb/>develop	CODE
HIGH	…1-4a2f-ace0-6113d752418a.training.segmentation.tei.xml	55	<body>scaling factor is γ(c) = G(c)E(c) <lb/>D(c) , where G(c), E(c) are the <lb/>gender-and ethnicity-shares of the	CODE
HIGH	…1-4a2f-ace0-6113d752418a.training.segmentation.tei.xml	79	<div type="annex">courier <lb/>barber <lb/>teller <lb/>contractor <lb/>magician <lb/>builder <lb/>printer <lb/>plumbe	CODE
HIGH	…ei/10.1515_med-2024-0960.training.segmentation.tei.xml	90	<body>In turn, inadequate proficiency in code reading and inter-<lb/>pretation present a security hazard [6], wi	CODE
HIGH	…ei/10.1515_cti-2024-0090.training.segmentation.tei.xml	97	<body>problems in the domain of work and cooperation. These <lb/>goals have obvious value, however we look to ex	CODE

Modern AI Meta-Vocabulary25 hits · 55 pts

Severity	File	Line	Snippet	Context
MEDIUM	…ion/corpus/tei/491._FrH8.training.segmentation.tei.xml	49	<body>observations made, with the obvious revision operator that concatenate a new observation <lb/>to the current ep	CODE
MEDIUM	…tion/corpus/tei/903906v1.training.segmentation.tei.xml	95	<body>MATERIALS AND METHODS <lb/>Search for PB1 Domains in Animalia, Protozoa and Fungi <lb/>To study the PB1 domains	CODE
MEDIUM	…corpus/tei/nihms-1007654.training.segmentation.tei.xml	7	<front>Multiscale Agent-Based and Hybrid Modeling of the Tumor <lb/>Immune Microenvironment <lb/>Kerri-Ann Norton #1,	CODE
MEDIUM	…371_journal.pone.0210033.training.segmentation.tei.xml	59	<listBibl>15. Jiang L, Luan Y, Miao X, Sun C, Li K, Huang Z,et al. Platelet releasate promotes breast cancer growth <	CODE
MEDIUM	…on/corpus/tei/PMC8446315.training.segmentation.tei.xml	137	<listBibl>REFERENCES <lb/>Arakawa, K., Miyasaka, T., & Ochi, H. (1974). Studies of het-<lb/>erocyclic compounds.	CODE
MEDIUM	…on/corpus/tei/PMC5877874.training.segmentation.tei.xml	129	<listBibl>36. Farnet CM, Haseltine WA. Determination of viral proteins present in the human immunodeficiency <lb/>vir	CODE
MEDIUM	…ght/corpus/tei/491._FrH8.training.segmentation.tei.xml	49	<body>observations made, with the obvious revision operator that concatenate a new observation <lb/>to the current ep	CODE
MEDIUM	…ight/corpus/tei/903906v1.training.segmentation.tei.xml	95	<body>MATERIALS AND METHODS <lb/>Search for PB1 Domains in Animalia, Protozoa and Fungi <lb/>To study the PB1 domains	CODE
MEDIUM	…corpus/tei/nihms-1007654.training.segmentation.tei.xml	7	<front>Multiscale Agent-Based and Hybrid Modeling of the Tumor <lb/>Immune Microenvironment <lb/>Kerri-Ann Norton #1,	CODE
MEDIUM	…371_journal.pone.0210033.training.segmentation.tei.xml	59	<listBibl>15. Jiang L, Luan Y, Miao X, Sun C, Li K, Huang Z,et al. Platelet releasate promotes breast cancer growth <	CODE
MEDIUM	…ht/corpus/tei/PMC8446315.training.segmentation.tei.xml	137	<listBibl>REFERENCES <lb/>Arakawa, K., Miyasaka, T., & Ochi, H. (1974). Studies of het-<lb/>erocyclic compounds.	CODE
MEDIUM	…ht/corpus/tei/PMC5877874.training.segmentation.tei.xml	129	<listBibl>36. Farnet CM, Haseltine WA. Determination of viral proteins present in the human immunodeficiency <lb/>vir	CODE
MEDIUM	…rces/dataset/patent/citation/corpus/WO2006135786A2.xml	4	<fulltext-document system="ops.epo.org" fulltext-format="text-only" xmlns="http://www.epo.org/fulltext"><bibliographic-d	CODE
MEDIUM	…rces/dataset/patent/citation/corpus/WO2006135786A2.xml	7	where X is a functional moiety comprising one or more building blocks; Z is an oligonucleotide attached at its 3' termin	CODE
MEDIUM	…rces/dataset/patent/citation/corpus/WO2006135786A2.xml	27	<EMI ID=18.1></p><p>[0084] Examples of suitable substituents X include O, S and NR3.</p><p>[0085] Scaffold b	CODE
MEDIUM	…sources/dataset/patent/citation/corpus/EP2338492A1.xml	12	Figure 5. MK801 and CNQX reduce A[beta]-induced [Ca<2+>]! rises and abolish cell death in entorhinal cortex-hippoc	CODE
MEDIUM⚡	…rces/dataset/patent/citation/corpus/WO2006099747A1.xml	4	<fulltext-document system="ops.epo.org" fulltext-format="text-only" xmlns="http://www.epo.org/fulltext"><bibliographic-d	CODE
MEDIUM⚡	…rces/dataset/patent/citation/corpus/WO2006099747A1.xml	4	<fulltext-document system="ops.epo.org" fulltext-format="text-only" xmlns="http://www.epo.org/fulltext"><bibliographic-d	CODE
MEDIUM	…rces/dataset/patent/citation/corpus/US2011143428A1.xml	226	<tb><sep></p><p>[0627] Typically, a staining pattern score of about 2+ or higher in an IHC assay is diagn	CODE
MEDIUM	…rces/dataset/patent/citation/corpus/WO2005001076A2.xml	2928	Reagents. Dulbecco's Modified Essential Media (DMEM), Penicillin and Streptomycin, were obtained from Invitrogen, Carlsb	CODE
MEDIUM	…rces/dataset/patent/citation/corpus/WO2005001076A2.xml	2963	Retinal ganglion cell (RGC) lesions have been extensively used as models for various repair strategies in the adult mamm	CODE
MEDIUM	…rces/dataset/patent/citation/corpus/WO2004044220A2.xml	4	<fulltext-document system="ops.epo.org" fulltext-format="text-only" xmlns="http://www.epo.org/fulltext"><bibliographic-d	CODE
MEDIUM⚡	…rces/dataset/patent/citation/corpus/WO2004044220A2.xml	16	PROTEIN SEQUENCE HCV EI X-MMMNWSPTAALLRIPQAIMDMIAGAHWGVLAGIKYFSMVGNW-Z (SEQ ID NO : 4) HGB El X-WMAGKVEAVIFLTKLASQVPYAIA	CODE
MEDIUM⚡	…rces/dataset/patent/citation/corpus/WO2004044220A2.xml	16	PROTEIN SEQUENCE HCV EI X-MMMNWSPTAALLRIPQAIMDMIAGAHWGVLAGIKYFSMVGNW-Z (SEQ ID NO : 4) HGB El X-WMAGKVEAVIFLTKLASQVPYAIA	CODE
MEDIUM⚡	…rces/dataset/patent/citation/corpus/WO2005003158A2.xml	15	The BMP and Activin sub-families are subject to significant post-translational regulation, such as by TGF-beta binding p	CODE

Over-Commented Block40 hits · 40 pts

Severity	File	Line	Snippet	Context
LOW	…mentation/pragmatic_segmenter/abbreviation_replacer.rb	61	end	COMMENT
LOW	…e/sentence-segmentation/pragmatic_segmenter/cleaner.rb	21	# Example:	COMMENT
LOW	grobid-home/config/grobid-evaluation.yaml	321	- name: "copyright"	COMMENT
LOW	grobid-home/config/grobid-full.yaml	61	# the actual implementation for language recognition to be used (Cybozu or Lingua)	COMMENT
LOW	grobid-home/config/grobid-full.yaml	81	# embeddings are usually compiled as lmdb under delft/data (this parameter is ignored if only featured-engineered CR	COMMENT
LOW	grobid-home/config/grobid-full.yaml	101	#	COMMENT
LOW	grobid-home/config/grobid-full.yaml	361		COMMENT
LOW	grobid-home/config/grobid.yaml	41	# NOTE! To use the Crossref web API, you need normally to use it politely	COMMENT
LOW	grobid-home/config/grobid.yaml	61	# CORS configuration for the GROBID web API service	COMMENT
LOW	grobid-home/config/grobid.yaml	101	# Flavor inheritance	COMMENT
LOW	grobid-home/config/grobid.yaml	361	#engine: "delft"	COMMENT
LOW	grobid-home/config/grobid.yaml	381	# false -> models are loaded when needed, avoiding putting in memory useless models (only in case of CRF) but slow dow	COMMENT
LOW	grobid-home/scripts/run_evaluation.sh	1	#!/usr/bin/env bash	COMMENT
LOW	…org/grobid/trainer/AbstractTrainerIntegrationTest.java	61	File outputTrainingFile,	COMMENT
LOW	…/grobid/trainer/sax/TEIHeaderSaxParserOCRTraining.java	161	// e.printStackTrace();	COMMENT
LOW	…grobid/trainer/sax/TEIReferenceSegmenterSaxParser.java	101	// we note a line break	COMMENT
LOW	…grobid/trainer/sax/TEIReferenceSegmenterSaxParser.java	121	// accumulator.setLength(0);	COMMENT
LOW	…grobid/trainer/sax/TEIReferenceSegmenterSaxParser.java	141	// currentTag = "<other>";	COMMENT
LOW	…va/org/grobid/core/utilities/LayoutTokensUtilTest.java	101	IntStream.range(15, layoutTokens.size()).forEach(i -> layoutTokens.get(i).setY(30));	COMMENT
LOW	…java/org/grobid/core/visualization/AnnotationUtil.java	141	txtLink.setRectangle(rect);	COMMENT
LOW	…c/main/java/org/grobid/core/sax/PDFALTOSaxHandler.java	661	}*/	COMMENT
LOW	…in/java/org/grobid/core/layout/LayoutTokenization.java	41	// public List<LayoutToken> getLayoutTokens() {	COMMENT
LOW	…va/org/grobid/core/document/BasicStructureBuilder.java	481	// bib = new BibDataSet();	COMMENT
LOW	…e/src/main/java/org/grobid/core/document/Document.java	1501	//	COMMENT
LOW	…e/src/main/java/org/grobid/core/document/Document.java	1521	// figure.setY(maxUp);	COMMENT
LOW	…e/src/main/java/org/grobid/core/document/Document.java	1541	// localImages.add(image);	COMMENT
LOW	…main/java/org/grobid/core/document/DocumentSource.java	41	// private static final int DEFAULT_TIMEOUT = 30000;	COMMENT
LOW	…grobid/core/utilities/LevenshteinDistanceAligment.java	141	while (elements.size() <= j) {	COMMENT
LOW	…/java/org/grobid/core/utilities/SentenceUtilities.java	161	if (forbidden == null)	COMMENT
LOW	…c/main/java/org/grobid/core/utilities/UnicodeUtil.java	141	+ "]";	COMMENT
LOW	…ore/src/main/java/org/grobid/core/data/BiblioItem.java	4341	}	COMMENT
LOW	…ain/java/org/grobid/core/data/util/EmailSanitizer.java	121		COMMENT
LOW	…ain/java/org/grobid/core/data/util/EmailSanitizer.java	141	// j++;	COMMENT
LOW	…/src/main/resources/web/resources/pdf.js/web/viewer.js	7061	if (!this.hasEqualPageSizes) {	COMMENT
LOW	…/org/grobid/service/main/GrobidServiceApplication.java	81	environment.healthChecks().register("health-check", new HealthResource(configuration));	COMMENT
LOW	…/org/grobid/service/main/GrobidServiceApplication.java	101	// Shared holder for the application/business metrics (documents, latency, errors, in-flight,	COMMENT
LOW	.github/dependabot.yml	1	#	COMMENT
LOW	.github/workflows/codeql.yml	1	# For most projects, this workflow file will not need changing; you simply need	COMMENT
LOW	.github/workflows/ci-build-tag-custom.yml	41	TARGET_IMAGE: ${{ github.event.inputs.target_image }}	COMMENT
LOW	.github/workflows/evaluation.yml	1	name: End-to-end evaluation	COMMENT

Excessive Try-Catch Wrapping12 hits · 19 pts

Severity	File	Line	Snippet	Context
MEDIUM	grobid-home/scripts/preload_embeddings.py	36	print("Error: embedding name", embeddings_name, "is not registered in", path)	CODE
MEDIUM	grobid-home/scripts/preload_embeddings.py	65	print("Error: could not open embeddings file", embeddings_path)	CODE
LOW	…entation/article/light/corpus/tei/detailed_analysis.py	56	except Exception as e:	CODE
MEDIUM	…entation/article/light/corpus/tei/detailed_analysis.py	57	print(f"Error processing {file_path}: {e}")	CODE
LOW	…segmentation/article/light/corpus/tei/analyze_notes.py	52	except Exception as e:	CODE
MEDIUM	…segmentation/article/light/corpus/tei/analyze_notes.py	53	print(f"Error processing {file_path}: {e}")	CODE
LOW	grobid-trainer/scripts/check_note_consistency.py	48	except Exception as e:	CODE
MEDIUM	grobid-trainer/scripts/check_note_consistency.py	49	print(f"Error processing {xml_file_path}: {e}")	CODE
MEDIUM	grobid-trainer/scripts/check_note_consistency.py	103	print(f"Error: Directory {tei_directory} does not exist")	CODE
LOW	grobid-trainer/scripts/check_note_consistency.py	189	except Exception as e:	CODE
MEDIUM	grobid-trainer/scripts/check_note_consistency.py	190	print(f"Error saving report to {output_file}: {e}")	CODE
LOW	.github/scripts/evaluation/fetch_dataset.py	83	except Exception as e:	CODE

Deep Nesting14 hits · 14 pts

Severity	File	Line	Context
LOW	grobid-home/scripts/select_error_cases.py	106	CODE
LOW	grobid-home/scripts/preload_embeddings.py	26	CODE
LOW	…entation/article/light/corpus/tei/detailed_analysis.py	8	CODE
LOW	…entation/article/light/corpus/tei/detailed_analysis.py	69	CODE
LOW	…entation/article/light/corpus/tei/detailed_analysis.py	111	CODE
LOW	…entation/article/light/corpus/tei/detailed_analysis.py	128	CODE
LOW	…segmentation/article/light/corpus/tei/analyze_notes.py	8	CODE
LOW	…segmentation/article/light/corpus/tei/analyze_notes.py	64	CODE
LOW	…segmentation/article/light/corpus/tei/analyze_notes.py	78	CODE
LOW	grobid-trainer/scripts/check_note_consistency.py	96	CODE
LOW	.github/scripts/evaluation/fetch_dataset.py	77	CODE
LOW	.github/scripts/evaluation/compare_reports.py	58	CODE
LOW	.github/scripts/evaluation/compare_reports.py	89	CODE
LOW	.github/scripts/evaluation/compare_reports.py	136	CODE

Decorative Section Separators2 hits · 6 pts

Severity	File	Line	Snippet	Context
MEDIUM	grobid-home/config/grobid-full.yaml	97	# ------------------	COMMENT
MEDIUM	grobid-home/config/grobid.yaml	102	# ------------------	COMMENT

Fake / Example Data6 hits · 6 pts

Severity	File	Line	Snippet	Context
LOW	grobid-core/src/test/resources/test/tei-escape.xml	8	<div xmlns="http://www.tei-c.org/ns/1.0"><p>Lorem ipsum <ref type="bibr" target="#b0">$9,</ref><ref	CODE
LOW	…src/test/kotlin/org/grobid/core/data/BiblioItemTest.kt	906	pdfAuthor.setEmail("eee@example.org")	CODE
LOW	…src/test/kotlin/org/grobid/core/data/BiblioItemTest.kt	1003	leftover.setEmail("xy@example.org")	CODE
LOW	…/grobid/core/engines/FundingAcknowledgementParser.java	390	((Element) sentenceToMerge).replaceChild(child, new Text("placeholder"));	CODE
LOW	…main/resources/web/resources/bootstrap/js/bootstrap.js	1903	this.$element.attr('placeholder', $option.html());	CODE
LOW	…/resources/web/resources/bootstrap/js/bootstrap.min.js	6	!function(e){"use strict";e(function(){e.support.transition=function(){var e=function(){var e=document.createElement("bo	CODE

Unused Imports4 hits · 4 pts

Severity	File	Line	Context
LOW	grobid-home/scripts/select_error_cases.py	45	CODE
LOW	…segmentation/article/light/corpus/tei/analyze_notes.py	5	CODE
LOW	grobid-trainer/scripts/check_note_consistency.py	11	CODE
LOW	grobid-trainer/scripts/check_note_consistency.py	12	CODE

Self-Referential Comments1 hit · 3 pts

Severity	File	Line	Snippet	Context
MEDIUM	.github/workflows/ci-build-unstable.yml	53	# Creating the check run needs write access, which fork pull requests do not get.	COMMENT

Redundant / Tautological Comments1 hit · 2 pts

Severity	File	Line	Snippet	Context
LOW	grobid-home/scripts/run_evaluation.sh	170	# Set LD_LIBRARY_PATH to include Python environment libraries (e.g., libstdc++ for DeLFT/JEP)	COMMENT

Example Usage Blocks1 hit · 2 pts

Severity	File	Line	Snippet	Context
LOW	.github/scripts/evaluation/install_delft.sh	7	# Usage:	COMMENT

grobidOrg/grobid

Open-Source Code Quality, Security and Technical Debt Review